Lineage for d6fuzn1 (6fuz N:6-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744103Domain d6fuzn1: 6fuz N:6-113 [357630]
    Other proteins in same PDB: d6fuzn2
    automated match to d5m2jd_
    complexed with gol

Details for d6fuzn1

PDB Entry: 6fuz (more details), 2.7 Å

PDB Description: crystal structure of the tpr domain of klc1 in complex with the c- terminal peptide of jip1
PDB Compounds: (N:) Nanobody

SCOPe Domain Sequences for d6fuzn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fuzn1 b.1.1.1 (N:6-113) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityykdsvk
grftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtv

SCOPe Domain Coordinates for d6fuzn1:

Click to download the PDB-style file with coordinates for d6fuzn1.
(The format of our PDB-style files is described here.)

Timeline for d6fuzn1: