Lineage for d1a54a_ (1a54 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28133Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins)
  6. 28244Protein Phosphate-binding protein [53860] (1 species)
  7. 28245Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 28248Domain d1a54a_: 1a54 A: [35763]

Details for d1a54a_

PDB Entry: 1a54 (more details), 1.6 Å

PDB Description: phosphate-binding protein mutant a197c labelled with a coumarin fluorophore and bound to dihydrogenphosphate ion

SCOP Domain Sequences for d1a54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a54a_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveycyakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOP Domain Coordinates for d1a54a_:

Click to download the PDB-style file with coordinates for d1a54a_.
(The format of our PDB-style files is described here.)

Timeline for d1a54a_: