Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) |
Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) |
Protein Phosphate-binding protein [53860] (1 species) |
Species Escherichia coli [TaxId:562] [53861] (13 PDB entries) |
Domain d1ixh__: 1ixh - [35761] |
PDB Entry: 1ixh (more details), 0.98 Å
SCOP Domain Sequences for d1ixh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixh__ c.94.1.1 (-) Phosphate-binding protein {Escherichia coli} easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv veqvraawktnikdssgkply
Timeline for d1ixh__: