SCOP 1.75: Domain d1sbpa_: 1sbp A:

Lineage for d1sbpa_ (1sbp A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Sulphate-binding protein [53858] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53859] (1 PDB entry)

8. Domain d1sbpa_: 1sbp A: [35760]
   complexed with so4

Details for d1sbpa_

PDB Entry: 1sbp, 1.7 Å

PDB Description: 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding

PDB Compounds: (A:) sulfate-binding protein

SCOP Domain Sequences for d1sbpa_:

Sequence; same for both SEQRES and ATOM records:

>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]}
kdiqllnvsydptrelyeqynkafsahwkqetgdnvvidqshggsgkqatsvingieadt
vtlalaydvnaiaergridknwikrlpddsapytstivflvrkgnpkqihdwndlikpgv
svitpnpkssggarwnylaawgyalhhnnndqakaedfvkalfknvevldsgargstntf
vergigdvliaweneallatnelgkdkfeivtpsesilaeptvsvvdkvvekkdtkavae
aylkylyspegqeiaaknfyrprdadvakkyddafpklklftidevfggwakaqkdhfad
ggtfdqisk

Timeline for d1sbpa_:

• d1sbpa_ first appeared (with stable ids) in SCOP 1.55, called d1sbp__
  
• d1sbpa_ appears in SCOP 1.73
  
• d1sbpa_ appears in SCOPe 2.01
  
• d1sbpa_ appears in the current release, SCOPe 2.08