Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (15 species) not a true protein |
Species Poecilia reticulata [TaxId:8081] [357578] (1 PDB entry) |
Domain d5ycda_: 5ycd A: [357592] automated match to d3adka_ complexed with ap5, mg |
PDB Entry: 5ycd (more details), 1.8 Å
SCOPe Domain Sequences for d5ycda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ycda_ c.37.1.1 (A:) automated matches {Poecilia reticulata [TaxId: 8081]} dkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaimq kgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvdaka etmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavddv fgqvskaidal
Timeline for d5ycda_: