Lineage for d5nb1d2 (5nb1 D:113-229)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002644Domain d5nb1d2: 5nb1 D:113-229 [357587]
    automated match to d1li1c2

Details for d5nb1d2

PDB Entry: 5nb1 (more details), 2.82 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha4nc1
PDB Compounds: (D:) Collagen alpha-4(IV) chain

SCOPe Domain Sequences for d5nb1d2:

Sequence, based on SEQRES records: (download)

>d5nb1d2 d.169.1.0 (D:113-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqavavhsqdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapfl
ecqgrqgtchffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvky

Sequence, based on observed residues (ATOM records): (download)

>d5nb1d2 d.169.1.0 (D:113-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqavavhsqdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapfl
ecqgrqgtchffankysfwlttvsqaqrqkisrcqvcvky

SCOPe Domain Coordinates for d5nb1d2:

Click to download the PDB-style file with coordinates for d5nb1d2.
(The format of our PDB-style files is described here.)

Timeline for d5nb1d2: