Lineage for d5ni3c_ (5ni3 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein Green fluorescent protein, GFP [54513] (6 species)
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (282 PDB entries)
    Uniprot P42212
  8. Domain d5ni3c_: 5ni3 C: [357583]
    automated match to d2fzua_
    complexed with cl, db5, gol, na; mutant

Details for d5ni3c_

PDB Entry: 5ni3 (more details), 1.28 Å

PDB Description: sfgfp 204-204 mutant dimer
PDB Compounds: (C:) Green fluorescent protein

SCOPe Domain Sequences for d5ni3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ni3c_ d.22.1.1 (C:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstksvlskdpnekrdhmvllefvtaagithgm

SCOPe Domain Coordinates for d5ni3c_ are not available.

Timeline for d5ni3c_:

Domains from other chains:
(mouse over for more information)
d5ni3a_, d5ni3b_, d5ni3d_