Lineage for d5ycfa_ (5ycf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866352Species Xiphophorus maculatus [TaxId:8083] [357570] (1 PDB entry)
  8. 2866353Domain d5ycfa_: 5ycf A: [357580]
    automated match to d3adka_
    complexed with ap5

Details for d5ycfa_

PDB Entry: 5ycf (more details), 1.94 Å

PDB Description: crystal structure of xiphophorus maculatus adenylate kinase
PDB Compounds: (A:) adenylate kinase isoenzyme 1

SCOPe Domain Sequences for d5ycfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ycfa_ c.37.1.1 (A:) automated matches {Xiphophorus maculatus [TaxId: 8083]}
ikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaimqkg
elvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvdakaet
mvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavddvfa
qvskaidal

SCOPe Domain Coordinates for d5ycfa_:

Click to download the PDB-style file with coordinates for d5ycfa_.
(The format of our PDB-style files is described here.)

Timeline for d5ycfa_: