Lineage for d5ycdb_ (5ycd B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein automated matches [190087] (15 species)
    not a true protein
  7. Species Poecilia reticulata [TaxId:8081] [357578] (1 PDB entry)
  8. Domain d5ycdb_: 5ycd B: [357579]
    automated match to d3adka_
    complexed with ap5, mg

Details for d5ycdb_

PDB Entry: 5ycd (more details), 1.8 Å

PDB Description: crystal structure of poecilia reticulata adenylate kinase
PDB Compounds: (B:) Adenylayte kinase

SCOPe Domain Sequences for d5ycdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ycdb_ c.37.1.1 (B:) automated matches {Poecilia reticulata [TaxId: 8081]}
madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
dvfgqvskaidal

SCOPe Domain Coordinates for d5ycdb_ are not available.

Timeline for d5ycdb_:

Domains from other chains:
(mouse over for more information)
d5ycda_