SCOPe 2.07: Domain d5ycbb_: 5ycb B:

Lineage for d5ycbb_ (5ycb B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Notothenia coriiceps [TaxId:8208] [353563] (3 PDB entries)

8. Domain d5ycbb_: 5ycb B: [357572]
   automated match to d3adka_
   complexed with ap5, so4

Details for d5ycbb_

PDB Entry: 5ycb, 2.27 Å

PDB Description: crystal structure of notothenia coriiceps adenylate kinase variant

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d5ycbb_:

Sequence; same for both SEQRES and ATOM records:

>d5ycbb_ c.37.1.1 (B:) automated matches {Notothenia coriiceps [TaxId: 8208]}
akiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqaimqkgelv
pldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyidakgetmvk
rlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvdevfkqvs
taidal

Timeline for d5ycbb_:

• d5ycbb_ is new in SCOPe 2.07-stable
  
• d5ycbb_ appears in the current release, SCOPe 2.08