Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6g8nb_: 6g8n B: [357563] Other proteins in same PDB: d6g8na_, d6g8nc2, d6g8ne_, d6g8ng_, d6g8ni_, d6g8nj_, d6g8nk_, d6g8nl_, d6g8nn_, d6g8no_, d6g8nq2, d6g8ns_, d6g8nu_, d6g8nw_, d6g8nx_, d6g8ny_, d6g8nz_ automated match to d4cr2c_ complexed with cl, eqb, mg |
PDB Entry: 6g8n (more details), 3 Å
SCOPe Domain Sequences for d6g8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g8nb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d6g8nb_:
View in 3D Domains from other chains: (mouse over for more information) d6g8na_, d6g8nc1, d6g8nc2, d6g8nd_, d6g8ne_, d6g8nf_, d6g8ng_, d6g8nh_, d6g8ni_, d6g8nj_, d6g8nk_, d6g8nl_, d6g8nm_, d6g8nn_, d6g8no_, d6g8np_, d6g8nq1, d6g8nq2, d6g8nr_, d6g8ns_, d6g8nt_, d6g8nu_, d6g8nv_, d6g8nw_, d6g8nx_, d6g8ny_, d6g8nz_ |