Lineage for d1lafe_ (1laf E:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) 
Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (1 species) Species Salmonella typhimurium [TaxId:90371] [53857] (5 PDB entries) 
Domain d1lafe_: 1laf E: [35756]
Details for d1lafe_
PDB Entry: 1laf (more details), 2.06 Å
PDB Description: structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein
SCOP Domain Sequences for d1lafe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lafe_ c.94.1.1 (E:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium}
alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslk
akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs
tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf
agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd
SCOP Domain Coordinates for d1lafe_:
Click to download the PDB-style file with coordinates for d1lafe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lafe_:
- d1lafe_ appears in SCOP 1.57
- d1lafe_ appears in the current release, SCOPe 2.08
View in 3D