![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
![]() | Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
![]() | Protein automated matches [190046] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries) |
![]() | Domain d6gfie1: 6gfi E:8-57 [357550] Other proteins in same PDB: d6gfia_, d6gfib_, d6gfic2, d6gfie2 automated match to d1jc6a_ complexed with edo |
PDB Entry: 6gfi (more details), 2.3 Å
SCOPe Domain Sequences for d6gfie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gfie1 g.8.1.1 (E:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]} qaevgpcrarfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavcgs
Timeline for d6gfie1:
![]() Domains from other chains: (mouse over for more information) d6gfia_, d6gfib_, d6gfic1, d6gfic2 |