SCOPe 2.08: Domain d6gfie1: 6gfi E:8-57

Lineage for d6gfie1 (6gfi E:8-57)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)

8. Domain d6gfie1: 6gfi E:8-57 [357550]
   Other proteins in same PDB: d6gfia_, d6gfib_, d6gfic2, d6gfie2
   automated match to d1jc6a_
   complexed with edo

Details for d6gfie1

PDB Entry: 6gfi, 2.3 Å

PDB Description: structure of human mesotrypsin in complex with appi variant t11v/m17r/i18f/f34v

PDB Compounds: (E:) Amyloid-beta A4 protein

SCOPe Domain Sequences for d6gfie1:

Sequence; same for both SEQRES and ATOM records:

>d6gfie1 g.8.1.1 (E:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaevgpcrarfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavcgs

Timeline for d6gfie1:

• d6gfie1 first appeared in SCOPe 2.07