Lineage for d6gfic1 (6gfi C:8-57)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637507Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)
  8. 2637523Domain d6gfic1: 6gfi C:8-57 [357518]
    Other proteins in same PDB: d6gfia_, d6gfib_, d6gfic2, d6gfie2
    automated match to d1jc6a_
    complexed with edo

Details for d6gfic1

PDB Entry: 6gfi (more details), 2.3 Å

PDB Description: structure of human mesotrypsin in complex with appi variant t11v/m17r/i18f/f34v
PDB Compounds: (C:) Amyloid-beta A4 protein

SCOPe Domain Sequences for d6gfic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfic1 g.8.1.1 (C:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaevgpcrarfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavcgs

SCOPe Domain Coordinates for d6gfic1:

Click to download the PDB-style file with coordinates for d6gfic1.
(The format of our PDB-style files is described here.)

Timeline for d6gfic1:

2637523
d6gfic1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6gfic2