Lineage for d6gfic1 (6gfi C:8-57)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032711Protein automated matches [190046] (3 species)
    not a true protein
  7. 3032756Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)
  8. 3032772Domain d6gfic1: 6gfi C:8-57 [357518]
    Other proteins in same PDB: d6gfia_, d6gfib_, d6gfic2, d6gfie2
    automated match to d1jc6a_
    complexed with edo

Details for d6gfic1

PDB Entry: 6gfi (more details), 2.3 Å

PDB Description: structure of human mesotrypsin in complex with appi variant t11v/m17r/i18f/f34v
PDB Compounds: (C:) Amyloid-beta A4 protein

SCOPe Domain Sequences for d6gfic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfic1 g.8.1.1 (C:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaevgpcrarfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavcgs

SCOPe Domain Coordinates for d6gfic1:

Click to download the PDB-style file with coordinates for d6gfic1.
(The format of our PDB-style files is described here.)

Timeline for d6gfic1: