Lineage for d5nb1c1 (5nb1 C:5-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608561Domain d5nb1c1: 5nb1 C:5-112 [357504]
    automated match to d1li1c1

Details for d5nb1c1

PDB Entry: 5nb1 (more details), 2.82 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha4nc1
PDB Compounds: (C:) Collagen alpha-4(IV) chain

SCOPe Domain Sequences for d5nb1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nb1c1 d.169.1.0 (C:5-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfay
cnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceap

SCOPe Domain Coordinates for d5nb1c1:

Click to download the PDB-style file with coordinates for d5nb1c1.
(The format of our PDB-style files is described here.)

Timeline for d5nb1c1: