Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (6 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein automated matches [259360] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [357241] (6 PDB entries) |
Domain d6awjb_: 6awj B: [357475] automated match to d4nb4a_ complexed with adp, n7g |
PDB Entry: 6awj (more details), 2.5 Å
SCOPe Domain Sequences for d6awjb_:
Sequence, based on SEQRES records: (download)
>d6awjb_ c.55.1.14 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy tvlrgckpyyvengafsgaigalyl
>d6awjb_ c.55.1.14 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} mkvgidaggtlikivqeqdrtfkteltknidqvvewlnqqqieklcltggnagviaenin ipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtggg miqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhh ldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytv lrgckpyyvengafsgaigalyl
Timeline for d6awjb_: