Lineage for d6aufb_ (6auf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997928Species Novosphingobium pentaromativorans [TaxId:1088721] [357473] (1 PDB entry)
  8. 2997929Domain d6aufb_: 6auf B: [357474]
    automated match to d4awyb_
    complexed with cit, zn

Details for d6aufb_

PDB Entry: 6auf (more details), 2.6 Å

PDB Description: crystal structure of metalo beta lactamases mim-1 from novosphingobium pentaromativorans
PDB Compounds: (B:) Beta-lactamase-like protein

SCOPe Domain Sequences for d6aufb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aufb_ d.157.1.0 (B:) automated matches {Novosphingobium pentaromativorans [TaxId: 1088721]}
pttlatackgldgregwshpappahiygntwyvgtcgiasilvtsddghvlidsgpadaa
plvlanirklgfdpadvrwiltshehhdhagsiaelqkatgaqiaavasarqvlesgkps
addpqsgliegfppvhvarvlvdgdsvtlgrlaltvretpahspgsaswtwqacdeaftc
rmiayadsattisaddyrfsdhpdriarirtglsriaqlpcdilvtphpsasnlfdrlsg
kaplvnaqacaaysqaagsyfakrlaeeageaa

SCOPe Domain Coordinates for d6aufb_:

Click to download the PDB-style file with coordinates for d6aufb_.
(The format of our PDB-style files is described here.)

Timeline for d6aufb_: