Lineage for d6bfqf1 (6bfq F:2-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368560Domain d6bfqf1: 6bfq F:2-108 [357470]
    Other proteins in same PDB: d6bfqb2, d6bfqd2, d6bfqf2, d6bfqg1, d6bfqg2, d6bfqi1, d6bfqi2, d6bfqj1, d6bfqj2, d6bfqk1, d6bfqk2, d6bfql2
    automated match to d1um5l1

Details for d6bfqf1

PDB Entry: 6bfq (more details), 2.6 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies
PDB Compounds: (F:) Fab light chain

SCOPe Domain Sequences for d6bfqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfqf1 b.1.1.0 (F:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspssvsasvgdrvtitcrasqginrrlawyqqkpgkapkrliyavstlqsgvps
rfngsgsgtdftltvnnvqpddlamyfclqsnnypltfgggtkveik

SCOPe Domain Coordinates for d6bfqf1:

Click to download the PDB-style file with coordinates for d6bfqf1.
(The format of our PDB-style files is described here.)

Timeline for d6bfqf1: