SCOPe 2.07: Domain d6awwe_: 6aww E:

Lineage for d6awwe_ (6aww E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)

8. Domain d6awwe_: 6aww E: [357454]
   automated match to d4m9ba_
   complexed with bzj, na

Details for d6awwe_

PDB Entry: 6aww, 2.3 Å

PDB Description: structure of pr 10 allergen ara h 8.01 in complex with 3-hydroxy-2- naphthoic acid

PDB Compounds: (E:) Ara h 8 allergen

SCOPe Domain Sequences for d6awwe_:

Sequence, based on SEQRES records:

>d6awwe_ d.129.3.0 (E:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

Sequence, based on observed residues (ATOM records):

>d6awwe_ d.129.3.0 (E:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklveggsigkltlkyhtkgd
akpdeeelkkgkakgeglfraiegyvlanptqy

Timeline for d6awwe_:

• d6awwe_ is new in SCOPe 2.07-stable
  
• d6awwe_ appears in the current release, SCOPe 2.08