Lineage for d6awrb_ (6awr B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582652Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)
  8. 2582656Domain d6awrb_: 6awr B: [357451]
    automated match to d4m9ba_
    complexed with 2an, na, so4

Details for d6awrb_

PDB Entry: 6awr (more details), 1.6 Å

PDB Description: structure of pr 10 allergen ara h 8.01 in complex with ans
PDB Compounds: (B:) Ara h 8 allergen

SCOPe Domain Sequences for d6awrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6awrb_ d.129.3.0 (B:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

SCOPe Domain Coordinates for d6awrb_:

Click to download the PDB-style file with coordinates for d6awrb_.
(The format of our PDB-style files is described here.)

Timeline for d6awrb_: