Lineage for d6atob2 (6ato B:81-222)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326004Protein Class alpha GST [81349] (8 species)
  7. 2326017Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2326035Domain d6atob2: 6ato B:81-222 [357415]
    Other proteins in same PDB: d6atoa1, d6atob1
    automated match to d1k3ya1
    complexed with gsh, mpd

Details for d6atob2

PDB Entry: 6ato (more details), 1.55 Å

PDB Description: crystal structure of hgsta1-1 complexed with gsh and mpd in each subunit
PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d6atob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6atob2 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d6atob2:

Click to download the PDB-style file with coordinates for d6atob2.
(The format of our PDB-style files is described here.)

Timeline for d6atob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6atob1