Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.1: COMT-like [53336] (4 proteins) |
Protein automated matches [190251] (6 species) not a true protein |
Species Nannospalax galili [TaxId:1026970] [357296] (6 PDB entries) |
Domain d6aw6a_: 6aw6 A: [357412] automated match to d4p7ka_ complexed with so4 |
PDB Entry: 6aw6 (more details), 1.7 Å
SCOPe Domain Sequences for d6aw6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aw6a_ c.66.1.1 (A:) automated matches {Nannospalax galili [TaxId: 1026970]} gdtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpsl vlelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqd lipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflay vrgsssfecthyssyleymkvvdglekavykgpssp
Timeline for d6aw6a_: