Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries) |
Domain d6awvc_: 6awv C: [357407] automated match to d4m9ba_ complexed with 28e, bez, na |
PDB Entry: 6awv (more details), 2.55 Å
SCOPe Domain Sequences for d6awvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6awvc_ d.129.3.0 (C:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht kgdakpdeeelkkgkakgeglfraiegyvlanptqy
Timeline for d6awvc_: