Lineage for d1olca_ (1olc A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 711025Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
    contains an additional alpha+beta domain inserted in the N-terminal domain
  7. 711028Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries)
  8. 711052Domain d1olca_: 1olc A: [35740]
    complexed with ium

Details for d1olca_

PDB Entry: 1olc (more details), 2.1 Å

PDB Description: oligo-peptide binding protein (oppa) complexed with lys-lys-lys-ala
PDB Compounds: (A:) oligo-peptide binding protein

SCOP Domain Sequences for d1olca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olca_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 602]}
advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh

SCOP Domain Coordinates for d1olca_:

Click to download the PDB-style file with coordinates for d1olca_.
(The format of our PDB-style files is described here.)

Timeline for d1olca_: