Lineage for d6bfqj1 (6bfq J:19-110)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318797Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2318965Protein automated matches [190501] (4 species)
    not a true protein
  7. 2318966Species Human (Homo sapiens) [TaxId:9606] [187448] (23 PDB entries)
  8. 2319002Domain d6bfqj1: 6bfq J:19-110 [357394]
    Other proteins in same PDB: d6bfqb1, d6bfqb2, d6bfqd1, d6bfqd2, d6bfqf1, d6bfqf2, d6bfqg2, d6bfqi2, d6bfqj2, d6bfqk2, d6bfql1, d6bfql2
    automated match to d5d22b_

Details for d6bfqj1

PDB Entry: 6bfq (more details), 2.6 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies
PDB Compounds: (J:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d6bfqj1:

Sequence, based on SEQRES records: (download)

>d6bfqj1 a.26.1.2 (J:19-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgsltklkgplt
mmashykqhcpptpetscatqiitfesfkenl

Sequence, based on observed residues (ATOM records): (download)

>d6bfqj1 a.26.1.2 (J:19-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqearrllnlsrdtmnetvevisemfdlqeptclqtrlelykqglrgsltklkgpltmma
shykqhcpptpetscatqiitfesfkenl

SCOPe Domain Coordinates for d6bfqj1:

Click to download the PDB-style file with coordinates for d6bfqj1.
(The format of our PDB-style files is described here.)

Timeline for d6bfqj1: