| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein automated matches [190501] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187448] (23 PDB entries) |
| Domain d6bfqj1: 6bfq J:19-110 [357394] Other proteins in same PDB: d6bfqb1, d6bfqb2, d6bfqd1, d6bfqd2, d6bfqf1, d6bfqf2, d6bfqg2, d6bfqi2, d6bfqj2, d6bfqk2, d6bfql1, d6bfql2 automated match to d5d22b_ |
PDB Entry: 6bfq (more details), 2.6 Å
SCOPe Domain Sequences for d6bfqj1:
Sequence, based on SEQRES records: (download)
>d6bfqj1 a.26.1.2 (J:19-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgsltklkgplt
mmashykqhcpptpetscatqiitfesfkenl
>d6bfqj1 a.26.1.2 (J:19-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqearrllnlsrdtmnetvevisemfdlqeptclqtrlelykqglrgsltklkgpltmma
shykqhcpptpetscatqiitfesfkenl
Timeline for d6bfqj1: