Lineage for d1b2ha_ (1b2h A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846659Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
    contains an additional alpha+beta domain inserted in the N-terminal domain
  7. 846662Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries)
  8. 846683Domain d1b2ha_: 1b2h A: [35738]
    complexed with ace, ium, orn

Details for d1b2ha_

PDB Entry: 1b2h (more details), 1.9 Å

PDB Description: Oligo-Peptide Binding Protein Complexed with Lysyl-Ornithyl-Lysine
PDB Compounds: (A:) periplasmic oligopeptide-binding protein

SCOP Domain Sequences for d1b2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2ha_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 90371]}
advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh

SCOP Domain Coordinates for d1b2ha_:

Click to download the PDB-style file with coordinates for d1b2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1b2ha_: