Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (45 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [357249] (6 PDB entries) |
Domain d6aysd1: 6ays D:1-228 [357378] Other proteins in same PDB: d6aysa2, d6aysb2, d6aysc2, d6aysd2, d6ayse2, d6aysf2, d6aysg2, d6aysh2 automated match to d4p54a_ complexed with edo, ht6 |
PDB Entry: 6ays (more details), 1.7 Å
SCOPe Domain Sequences for d6aysd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aysd1 c.56.2.0 (D:1-228) automated matches {Campylobacter jejuni [TaxId: 197]} mkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsas vmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifik tdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasvalv cdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
Timeline for d6aysd1: