Lineage for d6aw7a_ (6aw7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892847Protein automated matches [190251] (6 species)
    not a true protein
  7. 2892856Species Nannospalax galili [TaxId:1026970] [357296] (6 PDB entries)
  8. 2892860Domain d6aw7a_: 6aw7 A: [357373]
    automated match to d4p7ka_
    complexed with ca, sah

Details for d6aw7a_

PDB Entry: 6aw7 (more details), 2.15 Å

PDB Description: 2.15a resolution structure of sah bound catechol o-methyltransferase (comt) from nannospalax galili
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d6aw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aw7a_ c.66.1.1 (A:) automated matches {Nannospalax galili [TaxId: 1026970]}
dtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslv
lelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdl
ipqlkkydvdtldlvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayv
rgsssfecthyssyleymkvvdglekavykgps

SCOPe Domain Coordinates for d6aw7a_:

Click to download the PDB-style file with coordinates for d6aw7a_.
(The format of our PDB-style files is described here.)

Timeline for d6aw7a_: