SCOPe 2.07: Domain d6axxa2: 6axx A:148-220

Lineage for d6axxa2 (6axx A:148-220)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (32 PDB entries)

8. Domain d6axxa2: 6axx A:148-220 [357365]
   Other proteins in same PDB: d6axxa1
   automated match to d2m8pa2
   complexed with cl, iod; mutant

Details for d6axxa2

PDB Entry: 6axx, 2.6 Å

PDB Description: structure of the t58a/i124a mutant of the hiv-1 capsid protein

PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6axxa2:

Sequence; same for both SEQRES and ATOM records:

>d6axxa2 a.28.3.0 (A:148-220) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqg

Timeline for d6axxa2:

• d6axxa2 is new in SCOPe 2.07-stable
  
• d6axxa2 appears in the current release, SCOPe 2.08