Lineage for d6fhpd_ (6fhp D:)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.78: C-terminal fragment of thermolysin [63387] (1 superfamily)
  4. Superfamily j.78.1: C-terminal fragment of thermolysin [63388] (1 family) (S)
  5. Family j.78.1.1: C-terminal fragment of thermolysin [63389] (1 protein)
  6. Protein C-terminal fragment of thermolysin [63390] (2 species)
  7. Species Geobacillus stearothermophilus [TaxId:1422] [357351] (1 PDB entry)
  8. Domain d6fhpd_: 6fhp D: [357352]
    automated match to d1trla_

Details for d6fhpd_

PDB Entry: 6fhp (more details), 1.7000000000000002 Å

PDB Description: daip in complex with a c-terminal fragment of thermolysin
PDB Compounds: (D:) thermolysin

SCOPe Domain Sequences for d6fhpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhpd_ j.78.1.1 (D:) C-terminal fragment of thermolysin {Geobacillus stearothermophilus [TaxId: 1422]}
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk

SCOPe Domain Coordinates for d6fhpd_ are not available.

Timeline for d6fhpd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6fhpc_