Lineage for d6d88b2 (6d88 B:244-428)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566555Domain d6d88b2: 6d88 B:244-428 [357346]
    Other proteins in same PDB: d6d88a1, d6d88b1, d6d88c1, d6d88d1, d6d88e_, d6d88f1, d6d88f2, d6d88f3
    automated match to d3rycd2
    complexed with acp, ca, g9k, gdp, gtp, mes, mg

Details for d6d88b2

PDB Entry: 6d88 (more details), 2.85 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 13f
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d6d88b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d88b2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d6d88b2:

Click to download the PDB-style file with coordinates for d6d88b2.
(The format of our PDB-style files is described here.)

Timeline for d6d88b2: