Lineage for d6avpa_ (6avp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884735Family c.55.1.14: Fumble-like [159623] (6 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2884782Protein automated matches [259360] (2 species)
    not a true protein
  7. 2884783Species Staphylococcus aureus [TaxId:1280] [357241] (6 PDB entries)
  8. 2884792Domain d6avpa_: 6avp A: [357344]
    automated match to d4nb4a_
    complexed with adp, mg, n7e

Details for d6avpa_

PDB Entry: 6avp (more details), 2.3 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with adp and pantothenate analog phosphate-meo-n5pan
PDB Compounds: (A:) Type II pantothenate kinase

SCOPe Domain Sequences for d6avpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6avpa_ c.55.1.14 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
tvlrgckpyyvengafsgaigalyl

SCOPe Domain Coordinates for d6avpa_:

Click to download the PDB-style file with coordinates for d6avpa_.
(The format of our PDB-style files is described here.)

Timeline for d6avpa_: