SCOPe 2.07: Domain d6atqb2: 6atq B:81-222

Lineage for d6atqb2 (6atq B:81-222)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d6atqb2: 6atq B:81-222 [357339]
   Other proteins in same PDB: d6atqa1, d6atqb1
   automated match to d1k3ya1
   complexed with mes, mpd

Details for d6atqb2

PDB Entry: 6atq, 2 Å

PDB Description: crystal structure of apo-hgsta1-1 exhibiting a new conformation of c- terminal helix

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d6atqb2:

Sequence; same for both SEQRES and ATOM records:

>d6atqb2 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d6atqb2:

• d6atqb2 is new in SCOPe 2.07-stable
  
• d6atqb2 appears in the current release, SCOPe 2.08