Lineage for d6dtpa_ (6dtp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (57 species)
    not a true protein
  7. 2843171Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries)
  8. 2843202Domain d6dtpa_: 6dtp A: [357320]
    automated match to d1fdsa_
    complexed with edo, em9, gol, peg, pge

Details for d6dtpa_

PDB Entry: 6dtp (more details), 2 Å

PDB Description: crystal structure of human 17beta-hydroxysteroid dehydrogenase type 1 complexed with em139
PDB Compounds: (A:) Estradiol 17-beta-dehydrogenase 1

SCOPe Domain Sequences for d6dtpa_:

Sequence, based on SEQRES records: (download)

>d6dtpa_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfg

Sequence, based on observed residues (ATOM records): (download)

>d6dtpa_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtagspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalra
pkptlryftterflpllrmrlddpsgsnyvtamhrevfg

SCOPe Domain Coordinates for d6dtpa_:

Click to download the PDB-style file with coordinates for d6dtpa_.
(The format of our PDB-style files is described here.)

Timeline for d6dtpa_: