SCOPe 2.08: Domain d6atrb1: 6atr B:3-80

Lineage for d6atrb1 (6atr B:3-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
   Uniprot P08263

8. Domain d6atrb1: 6atr B:3-80 [357316]
   Other proteins in same PDB: d6atra2, d6atrb2
   automated match to d1k3ya2
   complexed with bws, edo, gsn

Details for d6atrb1

PDB Entry: 6atr, 1.29 Å

PDB Description: crystal structure of hgsta1-1 complexed with two gsh analogues in each subunit

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d6atrb1:

Sequence; same for both SEQRES and ATOM records:

>d6atrb1 c.47.1.5 (B:3-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
ekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidg
mklvqtrailnyiaskyn

Timeline for d6atrb1:

• d6atrb1 first appeared in SCOPe 2.07