| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d6bfqb1: 6bfq B:2-108 [357308] Other proteins in same PDB: d6bfqb2, d6bfqd2, d6bfqf2, d6bfqg1, d6bfqg2, d6bfqi1, d6bfqi2, d6bfqj1, d6bfqj2, d6bfqk1, d6bfqk2, d6bfql2 automated match to d1um5l1 |
PDB Entry: 6bfq (more details), 2.6 Å
SCOPe Domain Sequences for d6bfqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bfqb1 b.1.1.0 (B:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspssvsasvgdrvtitcrasqginrrlawyqqkpgkapkrliyavstlqsgvps
rfngsgsgtdftltvnnvqpddlamyfclqsnnypltfgggtkveik
Timeline for d6bfqb1: