Lineage for d6awwb_ (6aww B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. Protein automated matches [190218] (21 species)
    not a true protein
  7. Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)
  8. Domain d6awwb_: 6aww B: [357304]
    automated match to d4m9ba_
    complexed with bzj, na

Details for d6awwb_

PDB Entry: 6aww (more details), 2.3 Å

PDB Description: structure of pr 10 allergen ara h 8.01 in complex with 3-hydroxy-2- naphthoic acid
PDB Compounds: (B:) Ara h 8 allergen

SCOPe Domain Sequences for d6awwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6awwb_ d.129.3.0 (B:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

SCOPe Domain Coordinates for d6awwb_ are not available.

Timeline for d6awwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6awwa_, d6awwc_, d6awwd_, d6awwe_