Lineage for d6d88f1 (6d88 F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (77 PDB entries)
  8. 3057226Domain d6d88f1: 6d88 F:1-76 [357288]
    Other proteins in same PDB: d6d88a1, d6d88a2, d6d88b1, d6d88b2, d6d88c1, d6d88c2, d6d88d1, d6d88d2, d6d88e_, d6d88f2, d6d88f3
    automated match to d3tiia1
    complexed with acp, ca, g9k, gdp, gtp, mes, mg

Details for d6d88f1

PDB Entry: 6d88 (more details), 2.85 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 13f
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d6d88f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d88f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d6d88f1:

Click to download the PDB-style file with coordinates for d6d88f1.
(The format of our PDB-style files is described here.)

Timeline for d6d88f1:

  • d6d88f1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13