SCOPe 2.07: Domain d6d88d1: 6d88 D:1-243

Lineage for d6d88d1 (6d88 D:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d6d88d1: 6d88 D:1-243 [357284]
   Other proteins in same PDB: d6d88a2, d6d88b2, d6d88c2, d6d88d2, d6d88e_, d6d88f1, d6d88f2, d6d88f3
   automated match to d4drxb1
   complexed with acp, ca, g9k, gdp, gtp, mes, mg

Details for d6d88d1

PDB Entry: 6d88, 2.85 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 13f

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d6d88d1:

Sequence; same for both SEQRES and ATOM records:

>d6d88d1 c.32.1.1 (D:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6d88d1:

• d6d88d1 is new in SCOPe 2.07-stable
  
• d6d88d1 appears in the current release, SCOPe 2.08