Lineage for d6athb1 (6ath B:173-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718191Domain d6athb1: 6ath B:173-309 [357273]
    Other proteins in same PDB: d6atha_
    automated match to d3ddqb1
    complexed with so4

Details for d6athb1

PDB Entry: 6ath (more details), 1.82 Å

PDB Description: cdk2/cyclin a/p27-kid-deltac
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d6athb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6athb1 a.74.1.1 (B:173-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
rmehlvlkvltfdlaap

SCOPe Domain Coordinates for d6athb1:

Click to download the PDB-style file with coordinates for d6athb1.
(The format of our PDB-style files is described here.)

Timeline for d6athb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6athb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6atha_