Lineage for d6asla_ (6asl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839499Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2839548Family c.1.16.4: Ssud-like monoxygenases [82275] (3 proteins)
  6. 2839558Protein automated matches [356719] (1 species)
    not a true protein
  7. 2839559Species Bacillus subtilis [TaxId:224308] [356720] (2 PDB entries)
  8. 2839561Domain d6asla_: 6asl A: [357272]
    automated match to d1tvla_
    complexed with fmn, lfn

Details for d6asla_

PDB Entry: 6asl (more details), 1.9 Å

PDB Description: crystal structure of flavin monooxygenase cmoj (earlier ytnj) bound with fmn
PDB Compounds: (A:) Putative monooxygenase MoxC

SCOPe Domain Sequences for d6asla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6asla_ c.1.16.4 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtyl
arffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemafprtl
figtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyrggtl
renlglgipq

SCOPe Domain Coordinates for d6asla_:

Click to download the PDB-style file with coordinates for d6asla_.
(The format of our PDB-style files is described here.)

Timeline for d6asla_: