Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (12 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries) |
Domain d6axva2: 6axv A:148-221 [357261] Other proteins in same PDB: d6axva1 automated match to d2m8pa2 complexed with 1b0, cl, iod; mutant |
PDB Entry: 6axv (more details), 2.77 Å
SCOPe Domain Sequences for d6axva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6axva2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacqgv
Timeline for d6axva2: