Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d6b9za2: 6b9z A:107-214 [357212] Other proteins in same PDB: d6b9za1, d6b9zc1, d6b9zc2, d6b9ze1, d6b9ze2 automated match to d1dn0a2 |
PDB Entry: 6b9z (more details), 1.82 Å
SCOPe Domain Sequences for d6b9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b9za2 b.1.1.2 (A:107-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d6b9za2:
View in 3D Domains from other chains: (mouse over for more information) d6b9zc1, d6b9zc2, d6b9ze1, d6b9ze2 |