Lineage for d5yb1b3 (5yb1 B:389-583)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. Domain d5yb1b3: 5yb1 B:389-583 [357210]
    automated match to d1n5ua3
    complexed with 8zr, plm

Details for d5yb1b3

PDB Entry: 5yb1 (more details), 2.62 Å

PDB Description: structure and function of human serum albumin-metal agent complex
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d5yb1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yb1b3 a.126.1.1 (B:389-583) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaal

SCOPe Domain Coordinates for d5yb1b3 are not available.

Timeline for d5yb1b3:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yb1b1, d5yb1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5yb1a1, d5yb1a2, d5yb1a3