SCOPe 2.05: Domain d1jeua_: 1jeu A:

Lineage for d1jeua_ (1jeu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries)

8. Domain d1jeua_: 1jeu A: [35719]
   complexed with ium

Details for d1jeua_

PDB Entry: 1jeu, 1.25 Å

PDB Description: oligo-peptide binding protein (oppa) complexed with kek

PDB Compounds: (A:) oligo-peptide binding protein

SCOPe Domain Sequences for d1jeua_:

Sequence; same for both SEQRES and ATOM records:

>d1jeua_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 90371]}
advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh

Timeline for d1jeua_:

• d1jeua_ first appeared (with stable ids) in SCOP 1.55
  
• d1jeua_ appears in SCOPe 2.04
  
• d1jeua_ appears in SCOPe 2.06
  
• d1jeua_ appears in the current release, SCOPe 2.08