SCOPe 2.07: Domain d6espa1: 6esp A:6-116

Lineage for d6espa1 (6esp A:6-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)

8. Domain d6espa1: 6esp A:6-116 [357189]
   Other proteins in same PDB: d6espa2
   automated match to d2w4fa_

Details for d6espa1

PDB Entry: 6esp

PDB Description: proteome-wide analysis of phospho-regulated pdz domain interactions

PDB Compounds: (A:) Protein scribble homolog

SCOPe Domain Sequences for d6espa1:

Sequence; same for both SEQRES and ATOM records:

>d6espa1 b.36.1.1 (A:6-116) automated matches {Homo sapiens [TaxId: 9606]}
parieeeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgd
kllevngvalqgaehheavealrgagtavqmrvwrermvepenavtitplr

Timeline for d6espa1:

• d6espa1 is new in SCOPe 2.07-stable
  
• d6espa1 appears in the current release, SCOPe 2.08