Lineage for d6espa1 (6esp A:6-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786065Protein Scribble (KIAA0147) [101731] (1 species)
  7. 2786066Species Human (Homo sapiens) [TaxId:9606] [101732] (9 PDB entries)
    Uniprot Q14160 680-951, 1096-1193 # structure of 1st PDZ domain is also known, 1XQ5
  8. 2786080Domain d6espa1: 6esp A:6-116 [357189]
    Other proteins in same PDB: d6espa2
    automated match to d2w4fa_

Details for d6espa1

PDB Entry: 6esp (more details)

PDB Description: proteome-wide analysis of phospho-regulated pdz domain interactions
PDB Compounds: (A:) Protein scribble homolog

SCOPe Domain Sequences for d6espa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6espa1 b.36.1.1 (A:6-116) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}
parieeeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgd
kllevngvalqgaehheavealrgagtavqmrvwrermvepenavtitplr

SCOPe Domain Coordinates for d6espa1:

Click to download the PDB-style file with coordinates for d6espa1.
(The format of our PDB-style files is described here.)

Timeline for d6espa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6espa2