Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class sigma GST [81351] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89061] (16 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
Domain d5ywxb2: 5ywx B:76-199 [357183] Other proteins in same PDB: d5ywxa1, d5ywxb1, d5ywxc1, d5ywxd1 automated match to d2cvda1 complexed with 93c, gol, gsh, mg |
PDB Entry: 5ywx (more details), 1.74 Å
SCOPe Domain Sequences for d5ywxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ywxb2 a.45.1.1 (B:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d5ywxb2: