Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Serratia sp. [TaxId:104623] [357157] (5 PDB entries) |
Domain d5zw0a1: 5zw0 A:1-230 [357177] Other proteins in same PDB: d5zw0a2, d5zw0b2 automated match to d3mpia1 |
PDB Entry: 5zw0 (more details), 2.54 Å
SCOPe Domain Sequences for d5zw0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zw0a1 e.6.1.0 (A:1-230) automated matches {Serratia sp. [TaxId: 104623]} mdfnlsnsqsdiyesayrfacdvldqdaqtrisqkilstelwkkaaaygfahgpvshqfg gselgaldtalmiealgkgsrdiglsfslcahlcacviplyrfgsselkdkyleslvtgk liaanaatepdagsdiynmqataqpceggyilngkkifitnapiadvfiiyaktnpdhgf lgvsafliekgtpglnvgevipkdclsncpwseivfndifipqsqrigme
Timeline for d5zw0a1: